PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09822
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ARR-B
Protein Properties Length: 624aa    MW: 67472.7 Da    PI: 6.5708
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09822genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.56e-28204257155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ +t+e+v+SHLQkYRl
  EMT09822 204 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDLMNVENITRENVASHLQKYRL 257
               79*******************.********************************8 PP

2Response_reg79.89.2e-27261341109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ +++l+++l++ +y +v+++ ++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+ge +++ + +  Ga 
      EMT09822  26 VLAVDDDPTCLKVLENLLRRCDY-HVTTTGQAATALRMLRENKdqFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGETQTVMKGITHGAC 120
                   799********************.***************888889*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+  e+l +
      EMT09822 121 DYLLKPVRLEQLKT 134
                   ***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.7E-1831624IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.4E-4323171No hitNo description
SuperFamilySSF521724.84E-3623144IPR011006CheY-like superfamily
SMARTSM004482.9E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.90525140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.5E-2426135IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.97E-2927140No hitNo description
Gene3DG3DSA:1.10.10.601.0E-29201262IPR009057Homeodomain-like
PROSITE profilePS5129411.189201260IPR017930Myb domain
SuperFamilySSF466896.81E-20202261IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-24204257IPR006447Myb domain, plants
PfamPF002492.2E-6206256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MTVEGRVSGG GDGGGGKDKF PVGMRVLAVD DDPTCLKVLE NLLRRCDYHV TTTGQAATAL  60
RMLRENKDQF DLVISDVHMP DMDGFKLLEL VGLEMDLPVI MLSANGETQT VMKGITHGAC  120
DYLLKPVRLE QLKTIWQHVI RRNTKNRGSD NDDAGQKGPN AEGENGGANR NKRQSRRDRD  180
DNGDDGDDSD ENSNDNGDSS SQKKPRVVWS VELHRKFVAA VNQLGIDKAV PKKILDLMNV  240
ENITRENVAS HLQKYRLYLK RMSMDASRQA NLVAALGGRN PAYSNMNSMD VFRHYNNAYG  300
RYRPVPTSSH SQSNNLVARM NSPSAYGMHG LLSPQSQPLH LGHAQNNLGT SLNDLGVNNG  360
NLIRGAHMST MGTGTSGNSF ANISNGAPLA PTNRAVQSLE SNNRQHLGRI NSSSTDSFSS  420
FASDSPHFPD LGRSSNTWQT AVPSNIQQLG QNGSMSQASL HGNGLRMEPV SSYAPPSNQI  480
TSLGNDMQNQ VAPLASNTLP MVFNQGAAPF TFGNSTNSRE ALNSNLAFSN SGINTSLPNL  540
RIDNSVVPRQ TLDGGNTGGV PSLQDGKIDQ QAVGNQLNYN NNDLVGTSGL QRELSGGLDD  600
IVVDMFRPDN DNGGIFIDTD WGLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-26200263164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3637600.0AK363760.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2018L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570765.10.0PREDICTED: two-component response regulator ORR24
SwissprotQ6H8050.0ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLW5H5G30.0W5H5G3_WHEAT; Uncharacterized protein
TrEMBLM8AZB00.0M8AZB0_AEGTA; Two-component response regulator ARR12
STRINGMLOC_3955.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-106response regulator 12